PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0475s0016.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family NF-YA
Protein Properties Length: 330aa    MW: 35966.9 Da    PI: 9.9098
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0475s0016.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA1032.7e-32156212158
            CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                          +ep+YVNaKQy++I++RRq Rak+e ekk+ +k+rkpylheSRh+hA+rR+Rg+gGrF
  Kalax.0475s0016.1.p 156 EEPVYVNAKQYNGIMRRRQIRAKAELEKKV-IKNRKPYLHESRHQHAMRRARGCGGRF 212
                          69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.0E-37154215IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.986155215IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.3E-28157212IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006165.8E-23158180IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860160180IPR018362CCAAT-binding factor, conserved site
PRINTSPR006165.8E-23189212IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MMQMKAESGN QRAGYSQQSR WPGFENTDNS STGIRERSLR STSENVNLVT VGAIDSQFSS  60
SMNIAGNFNK VIPSGIALRP DGYSGQGNQT LTTSQSTMSE NPSESSQREL VDGSMVAASY  120
PYRDPSYGAI VPPYGQQALV YGVNQARMAL PLEMEEEPVY VNAKQYNGIM RRRQIRAKAE  180
LEKKVIKNRK PYLHESRHQH AMRRARGCGG RFLNTKKLNS ETSNSTSAAL DGTQHNGTLS  240
NQSILPRGLG NNLPASSSGY LYPLTEPQNS SFIPDTSMGH NIVSFGSSSS SSNIGGHDRS  300
SRYQTLPGDA QAYSSMQMTG PPRRTYPIT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-18156220266NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLV4U6251e-62V4U625_9R
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.42e-40nuclear factor Y, subunit A1